PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_426_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 301aa    MW: 35019.2 Da    PI: 9.1474
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_426_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.71.5e-13444343
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                  ie +  r +t+ kR+ g+ KKA+E  +LC++  ++ii++++
  Neem_426_f_4  4 IEKEKSRMITYQKRKRGLKKKASEFATLCGVPTCMIIYGPR 44
                  89999**********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.9E-4157IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.8E-14173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.778144IPR002100Transcription factor, MADS-box
CDDcd002663.34E-17172No hitNo description
PfamPF003193.0E-16448IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MELIEKEKSR MITYQKRKRG LKKKASEFAT LCGVPTCMII YGPRLNNRPT DVDVWPNDHK  60
DFMQVVNLYR EKAFSSVRGV KSQNLFDFFA DRKRKVDEKI AKTRKANYES KFSREFDEEF  120
NSFSIDQLKQ ILAVLDNNIE VATMKLTMIK GHQNYSIENS KPPELFLSPG YNNAAQILFS  180
ENIATDFFNK QQNIPLPLPA YHHHHCQPLQ LVPYDLNPMD NLMVMMNNGD QTGNVPLPLP  240
LQHAARYYDP MAAMLDNRMT MNNPRAGVRL QSYDEQFPVL PNISSQVHGS RLNEFYLYLW  300
K
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006427876.11e-106hypothetical protein CICLE_v10027125mg
TrEMBLV4SVC31e-106V4SVC3_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16227914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.12e-20AGAMOUS-like 82